Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

P65630

Expression Region

20-290

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Anti-Human Hepsin (2D5-1.9) Antibody
ICH1160-100mg 100 mg

Bulk Anti-Human Hepsin (2D5-1.9) Antibody

Sign In for Pricing
View Details
Mouse Adcy6 activation kit by CRISPRa
GA200074 1 Kit

Mouse Adcy6 activation kit by CRISPRa

Sign In for Pricing
View Details
Sez6l2 Mouse Gene Knockout Kit (CRISPR)
KN515638 1 Kit

Sez6l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benz[a]anthracene-d12
TRC-B183563-1G 1 g

Benz[a]anthracene-d12

Sign In for Pricing
View Details
ANTXR2 Rabbit Polyclonal Antibody
TA373538 100 µL

ANTXR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), CF405S conjugate, 0.1mg/mL
BNC041727-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details