Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A5IUN6

Expression Region

20-290

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteinase K Solution
BIO-37084 5ml @ 20mg/ml

Proteinase K Solution

Sign In for Pricing
View Details
CD86 Monoclonal Antibody
bsm-42111M 100 µL

CD86 Monoclonal Antibody

Sign In for Pricing
View Details
PKC alpha Recombinant Rabbit mAb, PE-Cy5 conjugated
orb3163969 100 µL

PKC alpha Recombinant Rabbit mAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Rat Succinate Dehydrogenase Complex Subunit B (SDHB) ELISA Kit
orb1662546-01 48 Tests

Rat Succinate Dehydrogenase Complex Subunit B (SDHB) ELISA Kit

Sign In for Pricing
View Details
Rat Succinate Dehydrogenase Complex Subunit B (SDHB) ELISA Kit
orb1662546-02 96 Tests

Rat Succinate Dehydrogenase Complex Subunit B (SDHB) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IRF2 Protein
E30P11035 20 µg

Recombinant Human IRF2 Protein

Sign In for Pricing
View Details