Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A6U3H6

Expression Region

20-290

Origin

Staphylococcus aureus (strain JH1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis PEEKsil 1/16x150umx10cm
CHR2583 5 / PCK

Kinesis PEEKsil 1/16x150umx10cm

Sign In for Pricing
View Details
Lentiviral human IBSP shRNA (UAS) - Lentiviral human IBSP shRNA (UAS) plasmid
GTR15115411 1 Vial

Lentiviral human IBSP shRNA (UAS) - Lentiviral human IBSP shRNA (UAS) plasmid

Sign In for Pricing
View Details
RPS10P28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV782880 1.0 µg DNA

RPS10P28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Lentiviral human ETV2 shRNA (UAS) - Lentiviral human ETV2 shRNA (UAS, RFP) (25)
GTR15133415 1 Vial

Lentiviral human ETV2 shRNA (UAS) - Lentiviral human ETV2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Tnnt2 Antibody
orb863996 2 mg

Tnnt2 Antibody

Sign In for Pricing
View Details
Human Down syndrome critical region protein 3, DSCR3 ELISA Kit
MBS9322958-01 48 Well

Human Down syndrome critical region protein 3, DSCR3 ELISA Kit

Sign In for Pricing
View Details