Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A7X4S6

Expression Region

20-290

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish DOCK1 Antibody Picoband® PE Conjugated
AZA8E1V6-PE 100 µg/Vial

Anti-Zebrafish DOCK1 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
RABL3 Rabbit pAb
A14327-01 20 µL

RABL3 Rabbit pAb

Sign In for Pricing
View Details
RABL3 Rabbit pAb
A14327-02 100 μL

RABL3 Rabbit pAb

Sign In for Pricing
View Details
RABL3 Rabbit pAb
A14327-03 500 μL

RABL3 Rabbit pAb

Sign In for Pricing
View Details
RABL3 Rabbit pAb
A14327-04 1000 μL

RABL3 Rabbit pAb

Sign In for Pricing
View Details
RBBP7 Protein Lysate
OCOA21406-20UG 20 µg

RBBP7 Protein Lysate

Sign In for Pricing
View Details