Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A7X4S6

Expression Region

20-290

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C9orf135 shRNA (UAS) - Lentiviral human C9orf135 shRNA (UAS) plasmid
GTR15330970 1 Vial

Lentiviral human C9orf135 shRNA (UAS) - Lentiviral human C9orf135 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Kinesin Family, Member 14 (KIF14) Antibody
abx177268-01 200 µg

Kinesin Family, Member 14 (KIF14) Antibody

Sign In for Pricing
View Details
Kinesin Family, Member 14 (KIF14) Antibody
abx177268-02 1 mg

Kinesin Family, Member 14 (KIF14) Antibody

Sign In for Pricing
View Details
PKD2 Protein Vector (Mouse) (pPM-C-His)
PV216505 500 ng

PKD2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human KIF1-binding protein Protein - (Dry Ice)
H00026128-P01-10ug 10 µg

Recombinant Human KIF1-binding protein Protein - (Dry Ice)

Sign In for Pricing
View Details
Scgb3a2 3'UTR GFP Stable Cell Line
TU269973 1.0 mL

Scgb3a2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details