Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 192 (TMEM192)

This Recombinant Human Transmembrane protein 192 (TMEM192) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Transmembrane protein 192

UniProt

Q8IY95

Expression Region

1-271

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLV FVVLAFLTGVLCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLLLECYIQYHHSK IRNRGYNLIYRSTRHLKRLALMIQSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALEL ICSLICLLIYTVKIRRFNKAKPEPDILEEEKIYAYPSNITSETGFRTISSLEEIVEKQGD TIEYLKRHNALLSKRLLALTSSDLGCQPSRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal GRAP Antibody
NB100-800 0.1 mg

Goat Polyclonal GRAP Antibody

Sign In for Pricing
View Details
Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate
OR92853-01 250 mg

Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate
OR92853-02 1 g

Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate
OR92853-03 5 g

Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate
OR92853-04 10 g

Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate
OR92853-05 25 g

Tert-Butyl (3S) -3-sulfanylpyrrolidine-1-carboxylate

Sign In for Pricing
View Details