Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q2FF36

Expression Region

20-290

Origin

Staphylococcus aureus (strain USA300)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), 1mg/mL
BNUM2592-50 1x 50 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), 1mg/mL

Sign In for Pricing
View Details
NCF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E5]
TA809198AM 100 µL

NCF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E5]

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF594 conjugate, 0.1mg/mL
BNC941010-100 1x 100 µL

Cytochrome C (CYCS/1010), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]
CF811375 100 µg

p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4A10]

Sign In for Pricing
View Details
CD166 Recombinant Rabbit Monoclonal Antibody [JE57-47]
HA722705 100 µL

CD166 Recombinant Rabbit Monoclonal Antibody [JE57-47]

Sign In for Pricing
View Details
Caspase 9 (CASP9) (NM_001229) Human Over-expression Lysate
LC400491 20 µg

Caspase 9 (CASP9) (NM_001229) Human Over-expression Lysate

Sign In for Pricing
View Details