Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q5HEA9

Expression Region

20-290

Origin

Staphylococcus aureus (strain COL)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Benzyl 3-ethyl 5-fluoropiperidine-1,3-dicarboxylate
PC430242 1 Each

1-Benzyl 3-ethyl 5-fluoropiperidine-1,3-dicarboxylate

Sign In for Pricing
View Details
CD43 (CD43 Antigen, Galactoglycoprotein, GALGP, GPL115, Leukocyte Sialoglycoprotein, Leukosialin, LSN, Sialophorin, SPN) (FITC)
MBS6249627-01 0.1 mL

CD43 (CD43 Antigen, Galactoglycoprotein, GALGP, GPL115, Leukocyte Sialoglycoprotein, Leukosialin, LSN, Sialophorin, SPN) (FITC)

Sign In for Pricing
View Details
CD43 (CD43 Antigen, Galactoglycoprotein, GALGP, GPL115, Leukocyte Sialoglycoprotein, Leukosialin, LSN, Sialophorin, SPN) (FITC)
MBS6249627-02 5x 0.1 mL

CD43 (CD43 Antigen, Galactoglycoprotein, GALGP, GPL115, Leukocyte Sialoglycoprotein, Leukosialin, LSN, Sialophorin, SPN) (FITC)

Sign In for Pricing
View Details
Monepantel
319893 5.0mg

Monepantel

Sign In for Pricing
View Details
GPT2 Rabbit Polyclonal Antibody (BF555)
orb2501158 100 µL

GPT2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus subsp. pastoris Queuine tRNA-ribosyltransferase (tgt)
MBS1420358-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus subsp. pastoris Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details