Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q6G7M0

Expression Region

20-290

Origin

Staphylococcus aureus (strain MSSA476)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octadecanedioic acid monoethyl ester
TRC-O362660-2.5G 2.5 g

Octadecanedioic acid monoethyl ester

Sign In for Pricing
View Details
TyraMaxTM 555/565 Amplification Dye, 100X
#96138-100UL 1x 100 µL

TyraMaxTM 555/565 Amplification Dye, 100X

Sign In for Pricing
View Details
Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit
E-UNEL-H0341-01 5x 96 Tests

Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit
E-UNEL-H0341-02 15x 96 Tests

Uncoated Human PD-L1 (Programmed Cell Death Protein 1 Ligand 1) ELISA Kit

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/3141R), CF568 conjugate, 0.1mg/mL
BNC683141-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/3141R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DHRS4L2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A10]
TA810277BM 100 µL

DHRS4L2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A10]

Sign In for Pricing
View Details