Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-290.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q6GEY5

Expression Region

20-290

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAIIILVLVIRIILLPFMLSNY KNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELMQVYKKYDMNPIKSMLGCLP MLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWITIIAGVLYFIQAYVSSKTM PDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFLVVQTHFANIYYEKVAKKEV QPFIEAYEREHNGGSNKKGKNTQVVSKKKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reep4 (NM_001025279) Rat Tagged ORF Clone
RR211652 10 µg

Reep4 (NM_001025279) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human CUL1 sgRNA gene knockout kit - Lentiviral human CUL1 sgRNA gene knockout kit (plasmid)
GTR15387653 1 Vial

Lentiviral human CUL1 sgRNA gene knockout kit - Lentiviral human CUL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ARIH1 Protein Vector (Human) (pPB-N-His)
PV063106 500 ng

ARIH1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
OR4F13P sgRNA CRISPR Lentivector (Human) (Target 1)
K1509002 1.0 µg DNA

OR4F13P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Fumarylacetoacetate hydrolase Rabbit Polyclonal Antibody (PE)
orb487952 100 µL

Fumarylacetoacetate hydrolase Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Anti-2019-nCoV S-hIgG1 Neutralizing Antibody
RD90422A-01 200 µL

Anti-2019-nCoV S-hIgG1 Neutralizing Antibody

Sign In for Pricing
View Details