Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3)

This Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q8NBV4

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITG HGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDV LSGFVIGYLQFRLVELVWMPSSTCQMLISAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS9BP sgRNA CRISPR Lentivector (Human) (Target 1)
K1817602 1.0 µg DNA

RGS9BP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ZDHHC15 Protein Lysate
OCOA20452-20UG 20 µg

ZDHHC15 Protein Lysate

Sign In for Pricing
View Details
Research Grade Tesnatilimab
DHD72101 100 μg

Research Grade Tesnatilimab

Sign In for Pricing
View Details
GPR75 Rabbit Polyclonal Antibody
TA315128 100 µL

GPR75 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sulconazole Nitrate Impurity 20
RM-S255020-01 10 mg

Sulconazole Nitrate Impurity 20

Sign In for Pricing
View Details
Sulconazole Nitrate Impurity 20
RM-S255020-02 100 mg

Sulconazole Nitrate Impurity 20

Sign In for Pricing
View Details