Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3)

This Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q8NBV4

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITG HGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDV LSGFVIGYLQFRLVELVWMPSSTCQMLISAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pum1 (NM_001159606) Mouse Tagged ORF Clone Lentiviral Particle
MR218112L3V 200 µL

Pum1 (NM_001159606) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ulocuplumab Biosimilar (Monoclonal, IgG4)
A138742 100 µL

Ulocuplumab Biosimilar (Monoclonal, IgG4)

Sign In for Pricing
View Details
Lentiviral mouse Cox8b shRNA (UAS) - Lentiviral mouse Cox8b shRNA (UAS, iRFP) plasmid
GTR15249328 1 Vial

Lentiviral mouse Cox8b shRNA (UAS) - Lentiviral mouse Cox8b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
FTH1 Recombinant Monoclonal Antibody
CSB-RA574579A0HU-01 50 μL

FTH1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
FTH1 Recombinant Monoclonal Antibody
CSB-RA574579A0HU-02 100 µL

FTH1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
SALL4
553225 100 µg

SALL4

Sign In for Pricing
View Details