Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3)

This Recombinant Human Probable lipid phosphate phosphatase PPAPDC3 (PPAPDC3) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Probable lipid phosphate phosphatase PPAPDC3, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 3

UniProt

Q8NBV4

Expression Region

1-271

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERR QSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITG HGIPWIGGTILCLVKSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPSLLD YLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCVGLSRVMIGRHHVTDV LSGFVIGYLQFRLVELVWMPSSTCQMLISAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtmr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
30909116 3x 1.0 µg

Mtmr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Primary Feline Splenic Mononuclear Cells (SpMC)
TRV-0018871 5x 10^5 Cells

Primary Feline Splenic Mononuclear Cells (SpMC)

Sign In for Pricing
View Details
Romo1 (NM_025946) Mouse Tagged Lenti ORF Clone
MR215929L3 10 µg

Romo1 (NM_025946) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
2-Fluoro-4-hydroxybenzaldehyde
sc-259835 1 g

2-Fluoro-4-hydroxybenzaldehyde

Sign In for Pricing
View Details
Anti-Yellowfever mosquito prospero Antibody-iFluor647 Conjugate
DZ33976-iFluor647 200 µL

Anti-Yellowfever mosquito prospero Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
IgM mu chain Antibody
OARA04450-50MG 50 mg

IgM mu chain Antibody

Sign In for Pricing
View Details