Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P0AB99

Expression Region

1-271

Origin

Escherichia coli O157:H7

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLF RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-c-RAF (pY341) Antibody
DL98760A-01 50 µL

Rabbit anti-c-RAF (pY341) Antibody

Sign In for Pricing
View Details
Rabbit anti-c-RAF (pY341) Antibody
DL98760A-02 100 µL

Rabbit anti-c-RAF (pY341) Antibody

Sign In for Pricing
View Details
Recombinant KRT14 Antibody / Keratin 14 / Cytokeratin 14
V4478-20UG 20 µg

Recombinant KRT14 Antibody / Keratin 14 / Cytokeratin 14

Sign In for Pricing
View Details
ZMYND8 (E9L1W) Rabbit Monoclonal Antibody
CST 33625T 20 µL

ZMYND8 (E9L1W) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UBXN2A (C-term) Rabbit pAb
E2611565 100 µL

UBXN2A (C-term) Rabbit pAb

Sign In for Pricing
View Details
NET1 CytoSection
TS401682P5 25 Slides

NET1 CytoSection

Sign In for Pricing
View Details