Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1AHR8

Expression Region

1-271

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNPPATFWTINIDSMFFSVVLGLLFLVLF RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WHSC1L1P CRISPR Knock Out 293T Cell Line (Human)
69055141 1x 10^6 Cells / 1.0 mL

WHSC1L1P CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human PDGF-D MAb (Clone 680018)
MAB1159-100 100 µg

Human PDGF-D MAb (Clone 680018)

Sign In for Pricing
View Details
ZFAND2A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50818064 1.0 µg DNA

ZFAND2A Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Vom1r58 Protein Vector (Rat) (pPM-C-His)
PV315501 500 ng

Vom1r58 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CLN6 Antibody, Biotin conjugated
MBS7105428-01 0.05 mg

CLN6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CLN6 Antibody, Biotin conjugated
MBS7105428-02 0.1 mg

CLN6 Antibody, Biotin conjugated

Sign In for Pricing
View Details