Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A ATP synthase subunit a (atpB)

This Recombinant Salmonella paratyphi A ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B5BIP2

Expression Region

1-271

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A12]
TA505099AM 100 µL

Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A12]

Sign In for Pricing
View Details
Drebrin Antibody
KC-2290-01 50 μL

Drebrin Antibody

Sign In for Pricing
View Details
Drebrin Antibody
KC-2290-02 100 µL

Drebrin Antibody

Sign In for Pricing
View Details
Drebrin Antibody
KC-2290-03 1 mL

Drebrin Antibody

Sign In for Pricing
View Details
Chloroiodoacetic Acid
TRC-C367170-2.5MG 2.5 mg

Chloroiodoacetic Acid

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), 0.2mg/mL
BNUB1537-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), 0.2mg/mL

Sign In for Pricing
View Details