Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A ATP synthase subunit a (atpB)

This Recombinant Salmonella paratyphi A ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B5BIP2

Expression Region

1-271

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMF RSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2 (NM_001798) Human Over-expression Lysate
LC419741 20 µg

CDK2 (NM_001798) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF50 (ZSCAN22) activation kit by CRISPRa
GA117555 1 Kit

Human ZNF50 (ZSCAN22) activation kit by CRISPRa

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF405S conjugate, 0.1mg/mL
BNC043736-500 1x 500 µL

Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS645474 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details
Drying Oven BODR-401
BODR-401 1 Unit

Drying Oven BODR-401

Sign In for Pricing
View Details
POT1 (NM_015450) Human Over-expression Lysate
LY402436 100 µg

POT1 (NM_015450) Human Over-expression Lysate

Sign In for Pricing
View Details