Recombinant Escherichia coli ATP synthase subunit a (atpB)
This Recombinant Escherichia coli ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-271.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
B1LL65
Expression Region
1-271
Origin
Escherichia coli (strain SMS-3-5 / SECEC)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNPPATFWTINIDSMFFSVVLGLLFLVLF RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP WAIFHILIITLQAFIFMVLTIVYLSMASEEH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680994-500 1x 500 µL
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401201-100 1x 100 µL
Neurofilament (H+L) (RT-97 + NR-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402711-100 1x 100 µL
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details