Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative G-protein coupled receptor GPCR39

This Recombinant Human Putative G-protein coupled receptor GPCR39 spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Putative G-protein coupled receptor GPCR39, hGPCR39

UniProt

Q8NGA4

Expression Region

1-272

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLG NGLVPWVTVFRMARTVSTVCFFHLALADFMLSLSLPILVYYIVSRQWLLGEWACKLYTGF VFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSALSAGSHLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAP2 Rabbit Polyclonal Antibody (BF405)
orb2437136 100 µL

NAP2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Lentiviral mouse Rapgef3 shRNA (UAS) - Lentiviral mouseRapgef3 shRNA (UAS, GFP) (25)
GTR15172568 1 Vial

Lentiviral mouse Rapgef3 shRNA (UAS) - Lentiviral mouseRapgef3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
L-Ornithine Monohydrochloride 99% For Biochemistry
01897 00100 100 g

L-Ornithine Monohydrochloride 99% For Biochemistry

Sign In for Pricing
View Details
IL-36γ (IL-1F9), Recombinant, Human (IL-1F, IL-1epsilon, IL-1H1) discontinued
143407-01 2 µg

IL-36γ (IL-1F9), Recombinant, Human (IL-1F, IL-1epsilon, IL-1H1) discontinued

Sign In for Pricing
View Details
IL-36γ (IL-1F9), Recombinant, Human (IL-1F, IL-1epsilon, IL-1H1) discontinued
143407-02 10 µg

IL-36γ (IL-1F9), Recombinant, Human (IL-1F, IL-1epsilon, IL-1H1) discontinued

Sign In for Pricing
View Details
RBMS3 (NM_014483) Human Tagged ORF Clone Lentiviral Particle
RC220037L3V 200 µL

RBMS3 (NM_014483) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details