Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative G-protein coupled receptor GPCR39

This Recombinant Human Putative G-protein coupled receptor GPCR39 spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Putative G-protein coupled receptor GPCR39, hGPCR39

UniProt

Q8NGA4

Expression Region

1-272

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLG NGLVPWVTVFRMARTVSTVCFFHLALADFMLSLSLPILVYYIVSRQWLLGEWACKLYTGF VFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSALSAGSHLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM5B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
20066066 1.0 µg DNA

FAM5B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Aprobarbital discontinued
259676-01 25 mg

Aprobarbital discontinued

Sign In for Pricing
View Details
Aprobarbital discontinued
259676-02 50 mg

Aprobarbital discontinued

Sign In for Pricing
View Details
Aprobarbital discontinued
259676-03 100 mg

Aprobarbital discontinued

Sign In for Pricing
View Details
NKX3-1, CT (NKX3-1, NKX3.1, NKX3A, Homeobox protein Nkx-3.1, Homeobox protein NK-3 homolog A) (MaxLight 750)
MBS6325618-01 0.1 mL

NKX3-1, CT (NKX3-1, NKX3.1, NKX3A, Homeobox protein Nkx-3.1, Homeobox protein NK-3 homolog A) (MaxLight 750)

Sign In for Pricing
View Details
NKX3-1, CT (NKX3-1, NKX3.1, NKX3A, Homeobox protein Nkx-3.1, Homeobox protein NK-3 homolog A) (MaxLight 750)
MBS6325618-02 5x 0.1 mL

NKX3-1, CT (NKX3-1, NKX3.1, NKX3A, Homeobox protein Nkx-3.1, Homeobox protein NK-3 homolog A) (MaxLight 750)

Sign In for Pricing
View Details