Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative G-protein coupled receptor GPCR39

This Recombinant Human Putative G-protein coupled receptor GPCR39 spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Putative G-protein coupled receptor GPCR39, hGPCR39

UniProt

Q8NGA4

Expression Region

1-272

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVSEGTRGCSDRQPGALTQGHSCSRKMNASRCLSEEVGSLRPLTMAVLSASFVVGVLG NGLVPWVTVFRMARTVSTVCFFHLALADFMLSLSLPILVYYIVSRQWLLGEWACKLYTGF VFLTFSTSNCLLVLISVDRCISVLYPVWALNHRTEQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCMQCYLQFNLENETAQMWTQEVFGRQMAVIMAHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSALSAGSHLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 Antibody
orb1712916 2 mL

MSH6 Antibody

Sign In for Pricing
View Details
CHN2 Adenovirus (Mouse)
16094055 1.0 mL

CHN2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Human Integrin β4,ITΒ4 ELISA KIT
JOT-EK3031Hu-01 96 Well

Human Integrin β4,ITΒ4 ELISA KIT

Sign In for Pricing
View Details
Human Integrin β4,ITΒ4 ELISA KIT
JOT-EK3031Hu-02 48 Well

Human Integrin β4,ITΒ4 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human KCNQ3 shRNA (UAS) - Lentiviral human KCNQ3 shRNA (UAS) plasmid
GTR15090907 1 Vial

Lentiviral human KCNQ3 shRNA (UAS) - Lentiviral human KCNQ3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Her2 Biosimilar Antibody
orb2670511-01 50 µg

Her2 Biosimilar Antibody

Sign In for Pricing
View Details