Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii ATP synthase subunit a (atpB)

This Recombinant Cronobacter sakazakii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A7MMW0

Expression Region

1-272

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAGEISTPQEYIGHHLNNLQIDLRTFSLVDPHNPPATFWTLNIDSMFFSVVLGLLFLVL FRKVAKHATSGVPGKFQTAVELVIGFVHGSVQDMYHGKSKLIAPLALTIFVWVFLMNLMD LLPIDLLPYIGEHVFGLPALRVVPSADVNITLSMALGVFILILFYSIKMKGVGGFTKELT LQPFNHPVFIPINLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWLLNV PWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3 alpha (GSK3A) pSer21 Rabbit Polyclonal Antibody
AP20890PU-N 100 µg

GSK3 alpha (GSK3A) pSer21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Peritoneum
CS712914 5x 5 µm

Tissue FFPE Sections, Peritoneum

Sign In for Pricing
View Details
H2N-Dpeg(4)-COOH Hydrochloride
TRC-H289595-250MG 250 mg

H2N-Dpeg(4)-COOH Hydrochloride

Sign In for Pricing
View Details
Recombinant Human CFHR2 Protein (His Tag)
PKSH032275-01 10 µg

Recombinant Human CFHR2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CFHR2 Protein (His Tag)
PKSH032275-02 50 µg

Recombinant Human CFHR2 Protein (His Tag)

Sign In for Pricing
View Details
Omp (NM_011010) Mouse Tagged ORF Clone
MG201298 10 µg

Omp (NM_011010) Mouse Tagged ORF Clone

Sign In for Pricing
View Details