Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein YtxD (ytxD)

This Recombinant Bacillus subtilis Uncharacterized protein YtxD (ytxD) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Uncharacterized protein YtxD

UniProt

P39063

Expression Region

1-272

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRFDYLTPVGFVLGTIIIVIGIISGSGVSGFRSFLDLTSFFIVTGGLCAAVFISFPPSE LKKAPSVLKQAFIRQEDNVKDLVKTFVSLSDHARKHGLLSLDDQAREIKDPFLKKGLLLA IDGWDEETIRLVMDSEIAAMEERHRKGRRVFEKAGEFAPAWGMIGTLVGLVLMLKNLNDP HMLGPNMAIALLTTLYGSLLANMVFNPIAAKLEEKTESEIFIKQVMVEGIIGVQSGKNPR NLESQLVVFSSREEWQKQPKQVKTKKGSVHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methamphetamine (BSA) (Higher Haptens)
471102 1 mg

Methamphetamine (BSA) (Higher Haptens)

Sign In for Pricing
View Details
Eco Alu MTP 13 plates 45mm, 615x135x92mm
TE15174 1 Piece

Eco Alu MTP 13 plates 45mm, 615x135x92mm

Sign In for Pricing
View Details
Neurocan Rabbit Polyclonal Antibody (APC)
orb995380 100 µL

Neurocan Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
GPR139 Antibody
MBS8513113-01 0.05 mg

GPR139 Antibody

Sign In for Pricing
View Details
GPR139 Antibody
MBS8513113-02 0.1 mg

GPR139 Antibody

Sign In for Pricing
View Details
GPR139 Antibody
MBS8513113-03 0.1 mL (AF750)

GPR139 Antibody

Sign In for Pricing
View Details