Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein YtxD (ytxD)

This Recombinant Bacillus subtilis Uncharacterized protein YtxD (ytxD) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Uncharacterized protein YtxD

UniProt

P39063

Expression Region

1-272

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRFDYLTPVGFVLGTIIIVIGIISGSGVSGFRSFLDLTSFFIVTGGLCAAVFISFPPSE LKKAPSVLKQAFIRQEDNVKDLVKTFVSLSDHARKHGLLSLDDQAREIKDPFLKKGLLLA IDGWDEETIRLVMDSEIAAMEERHRKGRRVFEKAGEFAPAWGMIGTLVGLVLMLKNLNDP HMLGPNMAIALLTTLYGSLLANMVFNPIAAKLEEKTESEIFIKQVMVEGIIGVQSGKNPR NLESQLVVFSSREEWQKQPKQVKTKKGSVHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WEE2 Antibody
MBS9233530-01 0.1 mL

Anti-WEE2 Antibody

Sign In for Pricing
View Details
Anti-WEE2 Antibody
MBS9233530-02 5x 0.1 mL

Anti-WEE2 Antibody

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein D (HSV I) (HRP) discontinued
H2033-19D-HRP 100 µL

Herpes Simplex Virus I, Glycoprotein D (HSV I) (HRP) discontinued

Sign In for Pricing
View Details
Phospho-ZIP Kinase (Thr265) Rabbit Polyclonal Antibody (PE)
orb505305 100 µL

Phospho-ZIP Kinase (Thr265) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
IFNGR1 polyclonal antibody
orb1718179-01 50 µL

IFNGR1 polyclonal antibody

Sign In for Pricing
View Details
IFNGR1 polyclonal antibody
orb1718179-02 100 µL

IFNGR1 polyclonal antibody

Sign In for Pricing
View Details