Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Glutamate transport system permease protein gluD (gluD)

This Recombinant Corynebacterium glutamicum Glutamate transport system permease protein gluD (gluD) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Glutamate transport system permease protein gluD

UniProt

P48245

Expression Region

1-273

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSGNGQLDANKWTPFINSQTWTTYILPGLWGTLKSAVFSVILALVMGTALGLGRISEIR ILRWFCAVIIETFRAIPVLILMIFAYQMFAQYNIVPSSQLAFAAVVFGLTMYNGSVIAEI LRSGIASLPKGQKEAAIALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQI GYIEVVRSGIQSASVNRNYLAALFVVALIMIVLNFSLTALASRIERQLRAGRARKNIVAK VPEQPDQGLETKDNVNVDWQDPDYKDLKTPGVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF647 conjugate, 0.1mg/mL
BNC472342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF568 conjugate, 0.1mg/mL
BNC680454-100 1x 100 µL

Neurofilament (NF-H) (RT-97), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL
BNC880416-100 1x 100 µL

Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF647 conjugate, 0.1mg/mL
BNC472029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details