Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 45A (Tmem45a)

This Recombinant Mouse Transmembrane protein 45A (Tmem45a) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Transmembrane protein 45A, 19.5, Dermal papilla-derived protein 7 homolog

UniProt

Q60774

Expression Region

1-273

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSFKGHALPGSFFFAMGFWWTMKNILKSVYKRQTRTCYLNSKTLLRRTEIWEGVVVLLM SLTGIAGEQFISGGPALILHKDGQWNQILGWHHTTMYLFFGLQGITQIICFTTNVLPLSS SKLMLSIAIFVETFMFYNHTHGREMIDIFVHQLLVFVGTFSGLVAFLEFLVKNNALLELL RCSLLMFQGTWFWQMAFVLYPPCGSATWNLSDIQNKMFLSMCFCWHYASILILIGVKYAL ANWLVKSRLRKGCTSEVGLLKHADREQESEEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cmah shRNA (UAS) - Lentiviral mouse Cmah shRNA (UAS, iRFP) plasmid
GTR15204856 1 Vial

Lentiviral mouse Cmah shRNA (UAS) - Lentiviral mouse Cmah shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid
SEA91956-01 0.5 g

2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid

Sign In for Pricing
View Details
2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid
SEA91956-02 5 g

2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid

Sign In for Pricing
View Details
mTOR Antibody: RPE
SPC-798D-RPE 0.1mg

mTOR Antibody: RPE

Sign In for Pricing
View Details
Lentiviral mouse Drg2 shRNA (UAS) - Lentiviral mouse Drg2 shRNA (UAS, RFP) plasmid
GTR15245353 1 Vial

Lentiviral mouse Drg2 shRNA (UAS) - Lentiviral mouse Drg2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-SAP97 Rabbit Monoclonal Antibody
MBS1756750-01 0.03 mL

Anti-SAP97 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details