Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 45A (Tmem45a)

This Recombinant Mouse Transmembrane protein 45A (Tmem45a) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Transmembrane protein 45A, 19.5, Dermal papilla-derived protein 7 homolog

UniProt

Q60774

Expression Region

1-273

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSFKGHALPGSFFFAMGFWWTMKNILKSVYKRQTRTCYLNSKTLLRRTEIWEGVVVLLM SLTGIAGEQFISGGPALILHKDGQWNQILGWHHTTMYLFFGLQGITQIICFTTNVLPLSS SKLMLSIAIFVETFMFYNHTHGREMIDIFVHQLLVFVGTFSGLVAFLEFLVKNNALLELL RCSLLMFQGTWFWQMAFVLYPPCGSATWNLSDIQNKMFLSMCFCWHYASILILIGVKYAL ANWLVKSRLRKGCTSEVGLLKHADREQESEEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK2 Antibody, FITC conjugated
CSB-PA012453LC01HU-01 50 µg

KLK2 Antibody, FITC conjugated

Sign In for Pricing
View Details
KLK2 Antibody, FITC conjugated
CSB-PA012453LC01HU-02 100 µg

KLK2 Antibody, FITC conjugated

Sign In for Pricing
View Details
YKL-40 Antibody
E51A02735 100 µL

YKL-40 Antibody

Sign In for Pricing
View Details
Interferon alpha 2a (Interferon alpha-2, IFN-alpha-2, IFNa2, IFNa2a, Interferon alpha-A, IFN-alphaA, IFNA, LeIF A, MGC125764, MGC125765) (MaxLight 405) discontinued
138054-ML405 100 µL

Interferon alpha 2a (Interferon alpha-2, IFN-alpha-2, IFNa2, IFNa2a, Interferon alpha-A, IFN-alphaA, IFNA, LeIF A, MGC125764, MGC125765) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SMD (Sulfametoxydiazine) ELISA Kit
E-FS-E165-01 96 Tests

SMD (Sulfametoxydiazine) ELISA Kit

Sign In for Pricing
View Details
SMD (Sulfametoxydiazine) ELISA Kit
E-FS-E165-02 3x 96 Tests

SMD (Sulfametoxydiazine) ELISA Kit

Sign In for Pricing
View Details