Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 6 (SCAMP6)

This Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 6 (SCAMP6) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Secretory carrier-associated membrane protein 6, Secretory carrier membrane protein 6

UniProt

Q0JAI9

Expression Region

1-273

Origin

Oryza sativa subsp. japonica (Rice)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHHDPNPFDEGNADDNPFSNGGGGGGGGGSRQQYGFRPTEPAGFGAGRGDATVDVPLDTM GDSKSKARELSSWETDLKRREADIKRREEALRNAGVPMEDKNWPPFFPIIHHDIANEIPA NLQKLQYLAFASWLGIVLCLSWNFIAVIVCWIKEGDSKLFFLATIYALLGIPLSYLIWYR PLYRAMRTNSAFSFGWFFLCYLIHIGFCIIAAIAPPIVFHGKSLTGILAAIDTFSEHVII GIFYFVGFALFCLETLLSIGVLQRVYMYFRGNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (DF1513), CF647 conjugate, 0.1mg/mL
BNC470188-100 1x 100 µL

CD71 (DF1513), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), CF405S conjugate, 0.1mg/mL
BNC040848-500 1x 500 µL

CD31 / PECAM-1 (C31.10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF488A conjugate, 0.1mg/mL
BNC881284-100 1x 100 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details