Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 202 (TMEM202)

This Recombinant Human Transmembrane protein 202 (TMEM202) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Transmembrane protein 202

UniProt

A6NGA9

Expression Region

1-273

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERREHLTLTFHSPEVPKIKGNRKYQRPTVPAKKHPSASMSCQRQQQLMDQAHIYIRTLC GSLCSFSLLMLIAMSPLNWVQFLVIKNGLELYAGLWTLCNHELCWSHTPKPPYYLQYSRA FFLISVFTILTGLGWLFSSWILNRGSMTTNLDLKVSMLSFISATCLLLCLNLFVAQVHWH TRDAMESDLLWTYYLNWCSDIFYMFAGIISLLNYLTSRSPACDENVTVIPTERSRLGVGP VTTVSPAKDEGPRSEMESLSVREKNLPKSGLWW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MBP Antibody
RC-4904-01 50 μL

Recombinant MBP Antibody

Sign In for Pricing
View Details
Recombinant MBP Antibody
RC-4904-02 100 µL

Recombinant MBP Antibody

Sign In for Pricing
View Details
Recombinant MBP Antibody
RC-4904-03 1 mL

Recombinant MBP Antibody

Sign In for Pricing
View Details
Sgsm3 Mouse Gene Knockout Kit (CRISPR)
KN515693 1 Kit

Sgsm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cortisone Sodium Succinate
TRC-C696505-25MG 25 mg

Cortisone Sodium Succinate

Sign In for Pricing
View Details
OGDH (NM_001003941) Human Over-expression Lysate
LY424041 100 µg

OGDH (NM_001003941) Human Over-expression Lysate

Sign In for Pricing
View Details