Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 202 (TMEM202)

This Recombinant Human Transmembrane protein 202 (TMEM202) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Transmembrane protein 202

UniProt

A6NGA9

Expression Region

1-273

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERREHLTLTFHSPEVPKIKGNRKYQRPTVPAKKHPSASMSCQRQQQLMDQAHIYIRTLC GSLCSFSLLMLIAMSPLNWVQFLVIKNGLELYAGLWTLCNHELCWSHTPKPPYYLQYSRA FFLISVFTILTGLGWLFSSWILNRGSMTTNLDLKVSMLSFISATCLLLCLNLFVAQVHWH TRDAMESDLLWTYYLNWCSDIFYMFAGIISLLNYLTSRSPACDENVTVIPTERSRLGVGP VTTVSPAKDEGPRSEMESLSVREKNLPKSGLWW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRAP1 activation kit by CRISPRa
GA114662 1 Kit

Human PRAP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Sulfonamides (SAs) ELISA Kit
RDF-E049 96 Tests

Sulfonamides (SAs) ELISA Kit

Sign In for Pricing
View Details
UGT8 (Center) Rabbit Polyclonal Antibody
AP54457PU-N 400 µL

UGT8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Integrin β5 Antibody
8C0235-AAT 50 µg

Integrin β5 Antibody

Sign In for Pricing
View Details
Mouse Fabp3 activation kit by CRISPRa
GA201346 1 Kit

Mouse Fabp3 activation kit by CRISPRa

Sign In for Pricing
View Details
Aldox Hydrochloride
TRC-A521005-2G 2 g

Aldox Hydrochloride

Sign In for Pricing
View Details