Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-5 protein (GJB5)

This Recombinant Human Gap junction beta-5 protein (GJB5) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Gap junction beta-5 protein, Connexin-31.1, Cx31.1

UniProt

O95377

Expression Region

1-273

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGC SNVCFDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNP GKKRGGLWWTYVCSLVFKASVDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKP SEKNIFTLFMVATAAICILLNLVELIYLVSKRCHECLAARKAQAMCTGHHPHGTTSSCKQ DDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX3L Antibody
KC-1899-01 50 μL

DTX3L Antibody

Sign In for Pricing
View Details
DTX3L Antibody
KC-1899-02 100 µL

DTX3L Antibody

Sign In for Pricing
View Details
DTX3L Antibody
KC-1899-03 1 mL

DTX3L Antibody

Sign In for Pricing
View Details
IBP1 Antibody
8C20806-AAT 50 µg

IBP1 Antibody

Sign In for Pricing
View Details
LATS2 (NM_014572) Human Over-expression Lysate
LY402348 100 µg

LATS2 (NM_014572) Human Over-expression Lysate

Sign In for Pricing
View Details
MAGEA10 (NM_001011543) Human Over-expression Lysate
LY423269 100 µg

MAGEA10 (NM_001011543) Human Over-expression Lysate

Sign In for Pricing
View Details