Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-5 protein (GJB5)

This Recombinant Human Gap junction beta-5 protein (GJB5) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Gap junction beta-5 protein, Connexin-31.1, Cx31.1

UniProt

O95377

Expression Region

1-273

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGC SNVCFDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNP GKKRGGLWWTYVCSLVFKASVDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKP SEKNIFTLFMVATAAICILLNLVELIYLVSKRCHECLAARKAQAMCTGHHPHGTTSSCKQ DDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycoprotein 2 (GP2) (NM_001502) Human Over-expression Lysate
LC419905 20 µg

Glycoprotein 2 (GP2) (NM_001502) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Relaxin-1/RLN1 Protein (His Tag)
PKSH031058 50 µg

Recombinant Human Relaxin-1/RLN1 Protein (His Tag)

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), RPE-AstralTM616 Conjugate - Biotium Choice
P015-R616-125 1x 125 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), RPE-AstralTM616 Conjugate - Biotium Choice

Sign In for Pricing
View Details
(E)-3-Hexenoic Acid
TRC-H294953-25G 25 g

(E)-3-Hexenoic Acid

Sign In for Pricing
View Details
Human CSKMT activation kit by CRISPRa
GA119051 1 Kit

Human CSKMT activation kit by CRISPRa

Sign In for Pricing
View Details
HDAC1 (C-term) Rabbit Polyclonal Antibody
AP11121PU-N 400 µL

HDAC1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details