Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-5 protein (GJB5)

This Recombinant Human Gap junction beta-5 protein (GJB5) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Gap junction beta-5 protein, Connexin-31.1, Cx31.1

UniProt

O95377

Expression Region

1-273

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWSIFEGLLSGVNKYSTAFGRIWLSLVFIFRVLVYLVTAERVWSDDHKDFDCNTRQPGC SNVCFDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREVQEKRHREAHGENSGRLYLNP GKKRGGLWWTYVCSLVFKASVDIAFLYVFHSFYPKYILPPVVKCHADPCPNIVDCFISKP SEKNIFTLFMVATAAICILLNLVELIYLVSKRCHECLAARKAQAMCTGHHPHGTTSSCKQ DDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK 2126458
TRC-G797500-1MG 1 mg

GSK 2126458

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS502311 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Fluo-3, AM Ester
#50014 1x 1 mg

Fluo-3, AM Ester

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF640R conjugate, 0.1mg/mL
BNC401409-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRIFIN (NM_001291784) Human Tagged ORF Clone
RG236066 10 µg

GRIFIN (NM_001291784) Human Tagged ORF Clone

Sign In for Pricing
View Details
CADM3 (NM_001127173) Human Recombinant Protein
TP720367L 500 µg

CADM3 (NM_001127173) Human Recombinant Protein

Sign In for Pricing
View Details