Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q663Q2

Expression Region

1-274

Origin

Yersinia pseudotuberculosis

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASGEISTPRDYIGHHLNHLQLDLRTFELVNPHSTGPATFWTLNIDSLFFSVVLGLAFL LVFRKVAASATSGVPGKLQTAVELIIGFVDNSVRDMYHGKSKVIAPLALTVFVWVLLMNM MDLLPIDLLPYIGEHVFGLPALRVVPTADVSITLSMALGVFILIIFYSIKMKGVGGFTKE LTMQPFNHPIFIPVNLILEGVSLLSKPLSLGLRLFGNMYAGELIFILIAGLLPWWSQWML SVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zidovudine, Antiretroviral; Enhances CRISPR repair
TBI4615-25MG 25 mg

Zidovudine, Antiretroviral; Enhances CRISPR repair

Sign In for Pricing
View Details
Rabbit anti-Pigeon Serum Albumin polyclonal Antibody, Biotin conjugated
MBS715331-01 0.05 mg

Rabbit anti-Pigeon Serum Albumin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-Pigeon Serum Albumin polyclonal Antibody, Biotin conjugated
MBS715331-02 0.1 mg

Rabbit anti-Pigeon Serum Albumin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-Pigeon Serum Albumin polyclonal Antibody, Biotin conjugated
MBS715331-03 5x 0.1 mg

Rabbit anti-Pigeon Serum Albumin polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Desmoplakin/DSP Rabbit Polyclonal Antibody (Fluoro594)
orb3117528 100 µg

Desmoplakin/DSP Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Z-VDVAD-FMK
A1922-S Evaluation Sample

Z-VDVAD-FMK

Sign In for Pricing
View Details