Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7CFM3

Expression Region

1-274

Origin

Yersinia pestis

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASGEISTPRDYIGHHLNHLQLDLRTFELVNPHSTGPATFWTLNIDSLFFSVVLGLAFL LVFRKVAASATSGVPGKLQTAVELIIGFVDNSVRDMYHGKSKVIAPLALTVFVWVLLMNM MDLLPIDLLPYIGEHVFGLPALRVVPTADVSITLSMALGVFILIIFYSIKMKGVGGFTKE LTMQPFNHPIFIPVNLILEGVSLLSKPLSLGLRLFGNMYAGELIFILIAGLLPWWSQWML SVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYDC1 (NM_138812) Human Tagged ORF Clone
RG205409 10 µg

DYDC1 (NM_138812) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human PI3 knockout cell line
ABC-KH11529 1 Vial

Human PI3 knockout cell line

Sign In for Pricing
View Details
NIPA2 Adenovirus (Human)
31841051 1.0 mL

NIPA2 Adenovirus (Human)

Sign In for Pricing
View Details
XAGE-1 Double Nickase Plasmid (h2)
sc-416985-NIC-2 20 µg

XAGE-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Fmoc-(Hmb)Gly-OH
B-3490.0005 5.0g

Fmoc-(Hmb)Gly-OH

Sign In for Pricing
View Details
PARP3 (Poly [ADP-ribose] Polymerase 3, PARP-3, hPARP-3, ADP-ribosyltransferase diphtheria toxin-like 3, ARTD3, IRT1, NAD (+) ADP-ribosyltransferase 3, ADPRT-3, Poly [ADP-ribose] Synthase 3, pADPRT-3, ADPRT3, ADPRTL3)
327552-01 50 µL

PARP3 (Poly [ADP-ribose] Polymerase 3, PARP-3, hPARP-3, ADP-ribosyltransferase diphtheria toxin-like 3, ARTD3, IRT1, NAD (+) ADP-ribosyltransferase 3, ADPRT-3, Poly [ADP-ribose] Synthase 3, pADPRT-3, ADPRT3, ADPRTL3)

Sign In for Pricing
View Details