Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Proteus mirabilis ATP synthase subunit a (atpB)

This Recombinant Proteus mirabilis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B4F0E1

Expression Region

1-274

Origin

Proteus mirabilis (strain HI4320)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASGEALTTRDYIGGHLNNLQLDLRTFELVNPHAENTPSFWVLNIDSLFFSVLMGLLFL WIFRKVAVKATSGVPGKFQTAVEMVIGFVDSSVRDMYHGKSKVIAPLALTVFVWVLLMNA LDLLPIDFIPYIGEHILGLPALRIVPTADVSITLSMAIGVFILILFYSIKMKGVKGFTKE LTLQPFNHPVFIPINLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWLL SLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(2,2-Difluoro-1,3-benzodioxol-5-yl)propan-2-amine
TRC-D302585-1G 1 g

1-(2,2-Difluoro-1,3-benzodioxol-5-yl)propan-2-amine

Sign In for Pricing
View Details
DUSP9 Rabbit Polyclonal Antibody
AP20456PU-N 100 µg

DUSP9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclophilin 40 (PPID) Rabbit Monoclonal Antibody
TA423633 100 µL

Cyclophilin 40 (PPID) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Amaranthus caudatus Lectin (Tassel flower, Inca wheat) -ACA-,  10nm
GP-8201-10 1 mL

Colloidal Gold Conjugated Amaranthus caudatus Lectin (Tassel flower, Inca wheat) -ACA-, 10nm

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS510768 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
PSP (REG1A) (NM_002909) Human Over-expression Lysate
LY401018 100 µg

PSP (REG1A) (NM_002909) Human Over-expression Lysate

Sign In for Pricing
View Details