Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Proteus mirabilis ATP synthase subunit a (atpB)

This Recombinant Proteus mirabilis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-274.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B4F0E1

Expression Region

1-274

Origin

Proteus mirabilis (strain HI4320)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASGEALTTRDYIGGHLNNLQLDLRTFELVNPHAENTPSFWVLNIDSLFFSVLMGLLFL WIFRKVAVKATSGVPGKFQTAVEMVIGFVDSSVRDMYHGKSKVIAPLALTVFVWVLLMNA LDLLPIDFIPYIGEHILGLPALRIVPTADVSITLSMAIGVFILILFYSIKMKGVKGFTKE LTLQPFNHPVFIPINLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWLL SLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LMBRD2 activation kit by CRISPRa
GA114194 1 Kit

Human LMBRD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Trim33 Mouse Gene Knockout Kit (CRISPR)
KN518204 1 Kit

Trim33 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCM2 Rabbit Polyclonal Antibody
AP26022PU-L 200 µg

CCM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS711408 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
beta 2 Microglobulin (B2M) Mouse Monoclonal Antibody [Clone ID: D3A2]
AM09265PU-N 500 µg

beta 2 Microglobulin (B2M) Mouse Monoclonal Antibody [Clone ID: D3A2]

Sign In for Pricing
View Details
Polyphyllin II
TRC-P689460-10MG 10 mg

Polyphyllin II

Sign In for Pricing
View Details