Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Fructose permease IID component (levG)

This Recombinant Bacillus subtilis Fructose permease IID component (levG) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Fructose permease IID component, EIID-Fru, PTS system fructose-specific EIID component, p30

UniProt

P26382

Expression Region

1-275

Origin

Bacillus subtilis (strain 168)

Field of Research

Musculoskeletal & Connective Tissue Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rtf1 (NM_030112) Mouse Tagged ORF Clone Lentiviral Particle
MR215339L4V 200 µL

Rtf1 (NM_030112) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SERPINB5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43480156 3x 1.0 µg DNA

SERPINB5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human Peroxisome Proliferator Activated Receptor Gamma (Recombinant)
22060618-1 2 µg

Human Peroxisome Proliferator Activated Receptor Gamma (Recombinant)

Sign In for Pricing
View Details
CD28 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-25688R-BF750 100 µL

CD28 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
NFKBIE (NF-kappa-B Inhibitor Epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon, NFKBIE, IKBE)
406804-01 50 µL

NFKBIE (NF-kappa-B Inhibitor Epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon, NFKBIE, IKBE)

Sign In for Pricing
View Details
NFKBIE (NF-kappa-B Inhibitor Epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon, NFKBIE, IKBE)
406804-02 100 µL

NFKBIE (NF-kappa-B Inhibitor Epsilon, NF-kappa-BIE, I-kappa-B-epsilon, IkB-E, IkB-epsilon, IkappaBepsilon, NFKBIE, IKBE)

Sign In for Pricing
View Details