Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 202 (Tmem202)

This Recombinant Mouse Transmembrane protein 202 (Tmem202) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Transmembrane protein 202

UniProt

Q80W35

Expression Region

1-275

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERKEQTMTFYSPEVIKIKGDLRYQRPTLPTNQQSVSTQKRQQYVNEACTYIRMFCGSLS GFSVLLLACTSPLNLVQFLVNNNGLELKAGLWTLCYHELCWSHTPKPPYYLQYSRALFLI SILFMLISLGLLLSSCRPAERMMSAELDLKVSMLSFCSAVSLLLCLNLFLAQVELYTKNA MEYEFLWTYYLSWCSEVLYICVGIISFLNFITFQFHPPDEGVSADLWQKSRLGIGPVPKT LSATAERSRSEMQFLSGRQEKLQNVRKGKLATTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Interleukin-17 Receptor Beta
MBS146732-01 0.002 mg

Recombinant Mouse Interleukin-17 Receptor Beta

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-17 Receptor Beta
MBS146732-02 0.01 mg

Recombinant Mouse Interleukin-17 Receptor Beta

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-17 Receptor Beta
MBS146732-03 1 mg

Recombinant Mouse Interleukin-17 Receptor Beta

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-17 Receptor Beta
MBS146732-04 5x 1 mg

Recombinant Mouse Interleukin-17 Receptor Beta

Sign In for Pricing
View Details
D-Maltotriose peracetate
TSW-00640-01 100 mg

D-Maltotriose peracetate

Sign In for Pricing
View Details
D-Maltotriose peracetate
TSW-00640-02 250 mg

D-Maltotriose peracetate

Sign In for Pricing
View Details