Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 72 (Tmem72)

This Recombinant Mouse Transmembrane protein 72 (Tmem72) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Transmembrane protein 72

UniProt

Q8C3K5

Expression Region

1-275

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLQVFWTGLEYTCRLLGIATAAVLIGVGTETFLRGRFKSLAFYLLFTGVTISVCEGTYF VAQLLAICFKCQPGSLAHRAKERAHWLGCFQKFLAYMLLSVACFLHPVLVWHVTIPGSML IITGLAYFLLSKRKKKKAAPEVAPPTEQYTDPSSSVVSTTGSGDTEQTYTFHEAFKEGPG SFFIHMKSILKGTKKPRVLQTQDTLMELALEPADSLAKKKQVHFEDNVVRIIPSLTEGLG DSDSEPEETSSDTTPIIPPSQTPHFLPSLMATDLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSTA (SLC51A) (NM_152672) Human Over-expression Lysate
LY403483 100 µg

OSTA (SLC51A) (NM_152672) Human Over-expression Lysate

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Rabbit Polyclonal Antibody
AP14396PU-N 400 µL

PDGF Receptor alpha (PDGFRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 26A1 Antibody
8C12254-AAT 50 µg

Cytochrome P450 26A1 Antibody

Sign In for Pricing
View Details
WNT8A (NM_058244) Human Over-expression Lysate
LY403304 100 µg

WNT8A (NM_058244) Human Over-expression Lysate

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF594 conjugate, 0.1mg/mL
BNC941859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse Immunoglobulins,  20nm
GAF-447-20 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Mouse Immunoglobulins, 20nm

Sign In for Pricing
View Details