Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 45A (TMEM45A)

This Recombinant Human Transmembrane protein 45A (TMEM45A) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Transmembrane protein 45A, DNA polymerase-transactivated protein 4, Dermal papilla-derived protein 7

UniProt

Q9NWC5

Expression Region

1-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNFRGHALPGTFFFIIGLWWCTKSILKYICKKQKRTCYLGSKTLFYRLEILEGITIVGM ALTGMAGEQFIPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPV SLTKLMLSNALFVEAFIFYNHTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLE LLRSSLILLQGSWFFQIGFVLYPPSGGPAWDLMDHENILFLTICFCWHYAVTIVIVGMNY AFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF647 conjugate, 0.1mg/mL
BNC473784-500 1x 500 µL

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perfluoro(butylcyclohexane)
TRC-P999370-1G 1 g

Perfluoro(butylcyclohexane)

Sign In for Pricing
View Details
Butyl Sodium Sulfate
TRC-B693875-250MG 250 mg

Butyl Sodium Sulfate

Sign In for Pricing
View Details
Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C4]
TA811199BM 100 µL

Nuclear Factor 1 (NFIA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C4]

Sign In for Pricing
View Details
Distillation Tester BPTL-245
BPTL-245 1 Unit

Distillation Tester BPTL-245

Sign In for Pricing
View Details
Frozen Tissue Sections, Pleura
CS502023 5x 5 µm

Frozen Tissue Sections, Pleura

Sign In for Pricing
View Details