Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 45A (TMEM45A)

This Recombinant Human Transmembrane protein 45A (TMEM45A) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Transmembrane protein 45A, DNA polymerase-transactivated protein 4, Dermal papilla-derived protein 7

UniProt

Q9NWC5

Expression Region

1-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNFRGHALPGTFFFIIGLWWCTKSILKYICKKQKRTCYLGSKTLFYRLEILEGITIVGM ALTGMAGEQFIPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPV SLTKLMLSNALFVEAFIFYNHTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLE LLRSSLILLQGSWFFQIGFVLYPPSGGPAWDLMDHENILFLTICFCWHYAVTIVIVGMNY AFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary: right
CS509338 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
1,3:2,4-Bis(O-benzylidene)-D-sorbitol
TRC-B535595-50MG 50 mg

1,3:2,4-Bis(O-benzylidene)-D-sorbitol

Sign In for Pricing
View Details
Sulfo-N-succinimidyl 6-(biotinamido) hexanoate Sodium Salt(~90%)
TRC-S699500-10MG 10 mg

Sulfo-N-succinimidyl 6-(biotinamido) hexanoate Sodium Salt(~90%)

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF488A conjugate, 0.1mg/mL
BNC881790-100 1x 100 µL

CD79a (B-Cell Marker) (IGA/1790R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AF647 Anti-Mouse CD22 Antibody
RD20382F-01 25 µg

AF647 Anti-Mouse CD22 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD22 Antibody
RD20382F-02 100 µg

AF647 Anti-Mouse CD22 Antibody

Sign In for Pricing
View Details