Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 45A (TMEM45A)

This Recombinant Human Transmembrane protein 45A (TMEM45A) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Transmembrane protein 45A, DNA polymerase-transactivated protein 4, Dermal papilla-derived protein 7

UniProt

Q9NWC5

Expression Region

1-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNFRGHALPGTFFFIIGLWWCTKSILKYICKKQKRTCYLGSKTLFYRLEILEGITIVGM ALTGMAGEQFIPGGPHLMLYDYKQGHWNQLLGWHHFTMYFFFGLLGVADILCFTISSLPV SLTKLMLSNALFVEAFIFYNHTHGREMLDIFVHQLLVLVVFLTGLVAFLEFLVRNNVLLE LLRSSLILLQGSWFFQIGFVLYPPSGGPAWDLMDHENILFLTICFCWHYAVTIVIVGMNY AFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Oxa-1,4-butanediol diacetate
TRC-O752250-250MG 250 mg

2-Oxa-1,4-butanediol diacetate

Sign In for Pricing
View Details
Casanthranol (A mixture of Casanthranol A, Casanthranol B, Cascaroside A and Cascaroside B) (Technical Grade)
TRC-C226503-5G 5 g

Casanthranol (A mixture of Casanthranol A, Casanthranol B, Cascaroside A and Cascaroside B) (Technical Grade)

Sign In for Pricing
View Details
Canine Interleukin 2 (IL2) ELISA Kit
RDR-IL2-c-01 96 Tests

Canine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 2 (IL2) ELISA Kit
RDR-IL2-c-02 48 Tests

Canine Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details
PRO-LAD
TRC-P834560-2.5MG 2.5 mg

PRO-LAD

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS710991 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details