Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative K (+) -stimulated pyrophosphate-energized sodium pump (hppA)

This Recombinant Putative K (+) -stimulated pyrophosphate-energized sodium pump (hppA) spans the amino acid sequence from region 1-275.

Product Specifications

Product Name Alternative

Putative K (+) -stimulated pyrophosphate-energized sodium pump, EC= 3.6.1.1, Membrane-bound sodium-translocating pyrophosphatase, Pyrophosphate-energized inorganic pyrophosphatase, Na (

UniProt

Q93NB7

Expression Region

1-275

Origin

Myxococcus xanthus

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGGTAVVMTVDAYGPISDNAGGISEMSGLGPEVRAITDELDAVGNTTAAIGKGFAIGSA TLTVIALFSAFNLEVNHTRIAAGLPEMSLQLTNPNVIVGLLLGSILPFLVGASTMLAVGR AAGAIVEEIGRQFREIPGLMELKADPDPKKIVDIATKSALQEMVFPGIIAVAAPPLVGYL LGPGALAGLLAGSLVVGATMALYMANAGGAWDNAKKFIEKGKLPGHAKGSAVHKAAVVGD MVGDPFKDTSGPGVAILIKVMSVVSLLVASLIALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-15958-01 50 μL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-15958-02 100 µL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-15958-03 1 mL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
YES1 (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 2B8]
AM00159PU-N 100 µg

YES1 (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 2B8]

Sign In for Pricing
View Details
ARSA (NM_001085425) Human Over-expression Lysate
LC421293 20 µg

ARSA (NM_001085425) Human Over-expression Lysate

Sign In for Pricing
View Details