Recombinant Avian nephritis virus 1 Non-structural polyprotein 1A (ORF1)

Non-structural polyprotein 1A, Cleaved into the following 4 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20'

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

KHKTKAISKAAFMKTKVLTEEEYRRLEEEGFTKDEIKDIVDNLREQAWLDYQNQLDEEGD DDWYEQMEEDQRINDQIDQNIERDLEDRGEWYGQRKITFKQRAMLRFIQLGRQQQVATVS FPDGYEDRAEELYNKVVTTEDLPEGETSEAALSLPNKIVHQAGKRLNFKHVKIHPDKTFM KSGVTQIEEKPEGDIILKAKTTTLAPKEEPVIQQVEQQPQVEQQQQPQQPVVEEKKRTPP PKPQRKPKTGAKAKCLDCGETFVERQDFHVCKSKN