Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Reaction center protein L chain (pufL)

This Recombinant Reaction center protein L chain (pufL) spans the amino acid sequence from region 2-276.

Product Specifications

Product Name Alternative

Reaction center protein L chain, Photosynthetic reaction center L subunit

UniProt

P10717

Expression Region

2-276

Origin

Rhodospirillum rubrum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALLSFERKYRVRGGTLIGGDLFDFWVGPFYVGFFGVTTLLFTVLGTALIVWGAALGPSWT FWQISINPPDVSYGLAMAPMAKGGLWQIITFSAIGAFVSWALREVEICRKLGIGYHIPFA FGFAILAYVSLVVIRPVMMGAWGYGFPYGFMTHLDWVSNTGYQYANFHYNPAHMLGITLF FTTCLALALHGSLILSAANPGKGEVVKGPEHENTYFQDTIGYSVGTLGIHRVGLILALSA VVWSIICMILSGPIYTGSWPDWWLWWQKLPFWNHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-100 1x 100 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details