Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium ulcerans Undecaprenyl-diphosphatase (uppP)

This Recombinant Mycobacterium ulcerans Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A0PQW1

Expression Region

1-276

Origin

Mycobacterium ulcerans (strain Agy99)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWWQVISLAVVQGLTEFLPVSSSGHLAVVSRVFFSDDAGASFTAVTQLGTEAAVLVYFA RDIVRILRAWFDGLVVKSHRNADYRLGWYVIIGTIPICVLGLLFKDEIRSGVRNLWVVAT ALVVFSGVIALAEYLGRQSRHVEQLTWRDGLVVGVAQTLALVPGVSRSGSTISAGLFLGL DRELAARFGFLLAIPAVFASGLFSLPDAFHPVTEGMSATGPQLLVATLIAFVVGLAAVSW FLRFLLRHSMYWFVGYRVVVGVVVLILLATGTVAAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1238), CF488A conjugate, 0.1mg/mL
BNC881238-100 1x 100 µL

Napsin-A (NAPSA/1238), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF640R conjugate, 0.1mg/mL
BNC401136-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923 + SMMS-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details