Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (OE1921R)

This Recombinant Halobacterium salinarum Digeranylgeranylglyceryl phosphate synthase (OE1921R) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

B0R3S1

Expression Region

1-276

Origin

Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METGRGLVELARPVNTLAAGALTFIGAFVAGGAVGRPAATGAAVGATWLATAGGNAINDY FDREVDRINDPDRAIPRGAVSPRGALAYSVVLFVGAAALAATLPVLAVCIAALNLAGLLT YTQYLKGRPGAGNALVAYLGGSTFVFGAAAVGSPLAGGVLAALAALSTFAREVIKDVEDL AGDRAAGLRTLPVVVGHQRALAVSAVFVVGAAAASPVPYLVGVFGWWYLVAVCPGVVVMV VAAARSYTDPAAGQRLLKRGQLLAAAAFVVGRLVTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF647 conjugate, 0.1mg/mL
BNC472231-100 1x 100 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LHX8 (NM_001001933) Human Over-expression Lysate
LY424281 100 µg

LHX8 (NM_001001933) Human Over-expression Lysate

Sign In for Pricing
View Details
SCRN2 (NM_138355) Human Recombinant Protein
TP303501L 1 mg

SCRN2 (NM_138355) Human Recombinant Protein

Sign In for Pricing
View Details
LGALS3 Antibody
KC-6270-01 50 μL

LGALS3 Antibody

Sign In for Pricing
View Details
LGALS3 Antibody
KC-6270-02 100 µL

LGALS3 Antibody

Sign In for Pricing
View Details
LGALS3 Antibody
KC-6270-03 1 mL

LGALS3 Antibody

Sign In for Pricing
View Details