Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q2FH56

Expression Region

1-276

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prostate Cancer Associated Fibroblasts
CAF10 1000000 Cells

Human Prostate Cancer Associated Fibroblasts

Sign In for Pricing
View Details
LAMP2 (NM_002294) Human Recombinant Protein
TP321216L 1 mg

LAMP2 (NM_002294) Human Recombinant Protein

Sign In for Pricing
View Details
PARG Mouse Monoclonal Antibody [Clone ID: OTI12G3]
CF808567 100 µg

PARG Mouse Monoclonal Antibody [Clone ID: OTI12G3]

Sign In for Pricing
View Details
A830023I12Rik (BC007165) Mouse Tagged ORF Clone
MG200051 10 µg

A830023I12Rik (BC007165) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Salivary alpha amylase (AMY1C) (NM_001008219) Human Over-expression Lysate
LC423396 20 µg

Salivary alpha amylase (AMY1C) (NM_001008219) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS633336 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details