Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppC2 (oppC2) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppC2

UniProt

Q2FH56

Expression Region

1-276

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O6-Ethyl-2’-deoxyguanosine
TRC-E913800-10MG 10 mg

O6-Ethyl-2’-deoxyguanosine

Sign In for Pricing
View Details
p73 (TP73) pTyr99 Rabbit Polyclonal Antibody
AP02357PU-S 50 µL

p73 (TP73) pTyr99 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS710437 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
AATOM™ 647N NHS ester
2856-AAT 1 mg

AATOM™ 647N NHS ester

Sign In for Pricing
View Details
Cenpa (NM_007681) Mouse Tagged ORF Clone
MG200793 10 µg

Cenpa (NM_007681) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TentaGel® S Ramage
S30025.5G 5 g

TentaGel® S Ramage

Sign In for Pricing
View Details